PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.DII8L
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 245aa    MW: 27751.1 Da    PI: 9.1147
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.DII8LgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1645.3e-51161401128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrFhPtdeelv +yLk+kv + +l++ ++i+evdi+k++PwdLp      e+e yfFs+r+ ky++g+r+nrat+sgyWkatg dk++ ++ ++
  Aradu.DII8L  16 LPPGFRFHPTDEELVAQYLKRKVFSCPLPA-SFIPEVDICKSDPWDLPGD---LEQERYFFSTREAKYPNGNRSNRATNSGYWKATGLDKHIATSkGH 109
                  79****************************.89***************54...46799**********************************998567 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  +l+g+kktLvfy+g+ p g++tdW+mheyrl
  Aradu.DII8L 110 QLIGMKKTLVFYRGKPPYGSRTDWIMHEYRL 140
                  77***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.09E-6012160IPR003441NAC domain
PROSITE profilePS5100558.0916160IPR003441NAC domain
PfamPF023659.4E-2817140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0010089Biological Processxylem development
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MEGRGSSFVK NGELRLPPGF RFHPTDEELV AQYLKRKVFS CPLPASFIPE VDICKSDPWD  60
LPGDLEQERY FFSTREAKYP NGNRSNRATN SGYWKATGLD KHIATSKGHQ LIGMKKTLVF  120
YRGKPPYGSR TDWIMHEYRL VSHSHLLPMQ NWVLCRIFFK RRAPANAKNV LLDHNSHSAS  180
ASEAFTISHE GSNSKVVFYD FLAQNRADLN RVPPPASSTS GTSGITTESD EHEDSSSCNS  240
FPFFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-511316114166NO APICAL MERISTEM PROTEIN
1ut4_B6e-511316114166NO APICAL MERISTEM PROTEIN
1ut7_A6e-511316114166NO APICAL MERISTEM PROTEIN
1ut7_B6e-511316114166NO APICAL MERISTEM PROTEIN
3swm_A6e-511316117169NAC domain-containing protein 19
3swm_B6e-511316117169NAC domain-containing protein 19
3swm_C6e-511316117169NAC domain-containing protein 19
3swm_D6e-511316117169NAC domain-containing protein 19
3swp_A6e-511316117169NAC domain-containing protein 19
3swp_B6e-511316117169NAC domain-containing protein 19
3swp_C6e-511316117169NAC domain-containing protein 19
3swp_D6e-511316117169NAC domain-containing protein 19
4dul_A6e-511316114166NAC domain-containing protein 19
4dul_B6e-511316114166NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00507DAPTransfer from AT5G13180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015962893.10.0PREDICTED: NAC domain-containing protein 83-like
SwissprotQ9FY931e-103NAC83_ARATH; NAC domain-containing protein 83
TrEMBLA0A0M5JAB41e-119A0A0M5JAB4_MANES; NAC transcription factors 35
STRINGGLYMA18G53954.11e-117(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.14e-97NAC domain containing protein 83